PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR07G06890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 403aa    MW: 44531.5 Da    PI: 6.8908
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR07G06890.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.1e-1898144148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      + +WT e+de l + v ++G++ W+ Ia+ ++ gRt+kqc++rw ++l
  LPERR07G06890.1  98 KRPWTREDDEVLRKMVIRHGNRKWAEIAKNLP-GRTGKQCRERWINHL 144
                      579*****************************.************996 PP

2Myb_DNA-binding55.81.1e-17150192145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ WT eEd++l++a+k +G   W+ Iar+++ gR+++++k++w+
  LPERR07G06890.1 150 KDVWTREEDKILIEAHKNYGES-WSVIARYLP-GRSGNNVKNHWY 192
                      578*****************88.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.91793148IPR017930Myb domain
SuperFamilySSF466891.03E-3095191IPR009057Homeodomain-like
SMARTSM007172.5E-1797146IPR001005SANT/Myb domain
PfamPF002492.2E-1698144IPR001005SANT/Myb domain
CDDcd001674.73E-17100144No hitNo description
Gene3DG3DSA:1.10.10.607.2E-24100148IPR009057Homeodomain-like
SMARTSM007172.2E-15149197IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-20149197IPR009057Homeodomain-like
PROSITE profilePS5129418.486149199IPR017930Myb domain
PfamPF002491.8E-15150192IPR001005SANT/Myb domain
CDDcd001672.56E-13153192No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MTATGNSFLN YEFLMTANSV PQRHFTSSTN VGAPITVEVP NLGCPGDRTS MAPSSFVMSE  60
WGQAAASYET LASNQVGTAM LSQQTQARGS NDKPPLIKRP WTREDDEVLR KMVIRHGNRK  120
WAEIAKNLPG RTGKQCRERW INHLHPNIKK DVWTREEDKI LIEAHKNYGE SWSVIARYLP  180
GRSGNNVKNH WYGTARRLNS KRQVKQTSLL EDYIRSKPSQ SIKTTPPMSG PEPFDNLEYN  240
TGLIGAGSTP AIQAPSFSTP PELMAYTSVL NSATIPSQLE SLDIFRTPVP TTLPLNTDHE  300
HHGDKYDLPS AAEGNLHFGG SHHIVGCQGS QPPYLGLYPS SSLAGSHVDG GTVAYDLQSF  360
NQANEGRHYY GEADPSSVGF GVMNDNDIIG QFMDDSDQSR WIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-37941973106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645903.11e-112PREDICTED: transcription factor RAX1-like
TrEMBLA0A0D9WX140.0A0A0D9WX14_9ORYZ; Uncharacterized protein
STRINGLOC_Os07g12130.11e-111(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.19e-43myb domain protein 98